CART Peptides
Cocaine and amphetamine-regulated transcript (CART) is a neuropeptide encoded by the CARTPT gene in humans. CART seems to play a role in reward, feeding, and stress, and exits the functional properties of an endogenous psychostimulant. It was discovered through examine changes in the brain taking cocaine or amphetamine administration.
There are various brain regions where CART is present. Upon giving CART to rats, the rats show increased locomotor activity, a symptom of “central stimulation” brought on by substances like amphetamine and cocaine. CART peptides, especially CART (55–102), likely to have an important function in energy balance regulation and interact with different central appetite circuits. The nucleus accumbens releases dopamine repeatedly, which leads to the production of CART, and CART may control neuronal activity in this area. CREB, a protein which is thought to have a role in the development of drug addiction, upregulates the production of CART. This suggest that CART is an important therapeutic target in the treatment of stimulant abuse.
Notice: All peptides are only for research purposes, Not for clinical use.
CART Peptides

- Name: CART (62-76), rat, human
- Sequence: YGQVPMCDAGEQCAV
- CAS Number: None
- Formula: C64H97N17O23S3
- Characteristics: (Cys68 and 74 bridge)
- Reference: None

- Name: CART (55-102), human
- Sequence: VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
- CAS Number: None
- Formula: C225H365N65O65S7
- Characteristics: (Cys20 and 40, Cys14 and 32, Cys34 and 47 bridge)
- Reference: None

- Name: CART (61-102) (human, rat)
- Sequence: KYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
- CAS Number: [209615-75-8]
- Formula: None
- Characteristics: None
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970