Calcitonin Gene-Related Peptide

Home » Peptide » Catalog Peptides » CGRP

Calcitonin gene-related peptide(CGRP) is a 37-amino acid neuropeotide, it is a member of calcitonin family of peptides, it is consisting of calcitonin, amylin, adrenomedullin, adrenomedullin 2, and calcitonin‑receptor‑stimulating peptide.

CGRP has protective mechanisms in the cardiovascular system, it is a highly potent vasodilator.  It is secreted and stored in the nervous system with two forms: CGRP alpha (α-CGRP or CGRP I), and CGRP beta (β-CGRP or CGRP II).

Notice: All peptides are only for research purposes, Not for clinical use.

CGRP Peptides

1.Calcitonin, salmon
  • Name: Calcitonin, salmon
  • Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Remark: Disulfide bond)
  • CAS Number: [47931-85-1]
  • Formula: C145H240N44O48S2
  • Characteristics: Cys1 and 7 bridge
  • Reference: DC.R. Hamilton, Am. J. Med., 56, 858 (1974)
2.Calcitonin, human
  • Name: Calcitonin, human
  • Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Remark: Disulfide bond)  
  • CAS Number: [21215-62-3]
  • Formula: C151H226N40O45S3
  • Characteristics: Cys1 and 7 bridge
  • Reference: Y. Nakagawa, et al., Peptide Chemistry, 1976, 189 (1977)
3.Calcitonin Gene Related Peptide, humanα-CGRP (human)
  • Name: Calcitonin Gene Related Peptide, human|α-CGRP (human)
  • Sequence: ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2  (Remark: Disulfide bond)
  • CAS Number: [90954-53-3]
  • Formula: C163H267N51O49S2
  • Characteristics: Cys2 and 7 bridge
  • Reference: P.Le Greves et al., Eur. J. Pharmacol., 115, 309 (1985)  H.R.Morris et al., Nature, 308, 746 (1984)
4.α-CGRP (8-37) (human)Calcitonin Gene Related Peptide (8-37), human
  • Name: α-CGRP (8-37) (human)|Calcitonin Gene Related Peptide (8-37), human
  • Sequence: VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
  • CAS Number: [119911-68-1]
  • Formula: C139H230N44O38
  • Characteristics: None
  • Reference: T. Chiba et al., Amer. J. Physiol., 256, E331 (1989)
5.Calcitonin Gene Related Peptide, rat
  • Name: Calcitonin Gene Related Peptide, rat
  • Sequence: SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2  (Remark: Disulfide bond)
  • CAS Number: [96827-03-1]
  • Formula: C162H262N50O52S2
  • Characteristics: Cys2 and 7 bridge
  • Reference: S.G. Amara, V. Jonas, M.G. Rosenfeld, E.S. Ong and R.M. Evans, Nature, 298, 240 (1982) (Original)  M.G. Rosenfeld, J.J. Mermond, S.G. Amara, L.W. Swanson, P.E. Sawchenko, J. Rivier, W.W. Vale and R.M. Evans, Nature, 304, 129 (1983)
Email us

PEPTIDE@QYAOBIO.COM

Call Us

+86(021)-50795728
+86(027)-60707970