Corticotropin Releasing Factor
Corticotropin releasing factor(CRF) is a peptide hormone in stress responses, it is the central regulator of the hypothalamic-pituitary-adrenal (HPA) axis. Corticotropin releasing factor is encoded by the CRH gene in human, it is also known as corticotropin-releasing hormone (CRH). It can stimulate the pituitary synthesis of adrenocorticotropic hormone (ACTH).
CRF is a 41-amino acid peptide, it is secreted by the paraventricular nucleus (PVN) of the hypothalamus in stress response.
Notice: All peptides are only for research purposes, Not for clinical use.
CRF Peptides
![1.CRF Corticotropin Releasing Factor, human, rat](https://www.qyaobio.com/wp-content/uploads/2023/07/1.CRFCorticotropin-Releasing-Factor-human-rat.jpg)
- Name: CRF|Corticotropin Releasing Factor, human, rat
- Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
- CAS Number: [86784-80-7]
- Formula: C208H344N60O63S2
- Characteristics: None
- Reference: S. Shibahara et al., The EMBO J., 2, 775 (1983)
![2.alpha-Helical CRF (9-41) alphaa-Helical Corticotropin Releasing Factor (9-41)](https://www.qyaobio.com/wp-content/uploads/2023/07/2.alpha-Helical-CRF-9-41-alphaa-Helical-Corticotropin-Releasing-Factor-9-41.jpg)
- Name: alpha-Helical CRF (9-41) |alpha|a-Helical Corticotropin Releasing Factor (9-41)
- Sequence: DLTFHLLREMLEMAKAEQEAEQAALNRLLLEEA-NH2
- CAS Number: [99658-03-4]
- Formula: C166H274N46O53S2
- Characteristics: None
- Reference: J. Rivier et al., Science, 224, 889 (1984)
![3.CRF Corticotropin Releasing Factor, bovine](https://www.qyaobio.com/wp-content/uploads/2023/07/3.CRF-Corticotropin-Releasing-Factor-bovine.jpg)
- Name: CRF Corticotropin Releasing Factor, bovine
- Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
- CAS Number: [92307-52-3]
- Formula: C206H340N60O63S
- Characteristics: None
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970