Corticotropin Releasing Factor

Home » Peptide » Catalog Peptides » CRF

Corticotropin releasing factor(CRF) is a peptide hormone in stress responses, it is the central regulator of the hypothalamic-pituitary-adrenal (HPA) axis. Corticotropin releasing factor is encoded by the CRH gene in human, it is also known as corticotropin-releasing hormone (CRH). It can stimulate the pituitary synthesis of adrenocorticotropic hormone (ACTH).

CRF is a 41-amino acid peptide, it is secreted by the paraventricular nucleus (PVN) of the hypothalamus in stress response.

Notice: All peptides are only for research purposes, Not for clinical use.

CRF Peptides

1.CRF Corticotropin Releasing Factor, human, rat
  • Name: CRF|Corticotropin Releasing Factor, human, rat
  • Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
  • CAS Number: [86784-80-7]
  • Formula: C208H344N60O63S2
  • Characteristics: None
  • Reference: S. Shibahara et al., The EMBO J., 2, 775 (1983)
2.alpha-Helical CRF (9-41) alphaa-Helical Corticotropin Releasing Factor (9-41)
  • Name: alpha-Helical CRF (9-41) |alpha|a-Helical Corticotropin Releasing Factor (9-41)
  • Sequence: DLTFHLLREMLEMAKAEQEAEQAALNRLLLEEA-NH2
  • CAS Number: [99658-03-4]
  • Formula: C166H274N46O53S2
  • Characteristics: None
  • Reference: J. Rivier et al., Science, 224, 889 (1984)
3.CRF Corticotropin Releasing Factor, bovine
  • Name: CRF Corticotropin Releasing Factor, bovine
  • Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
  • CAS Number: [92307-52-3]
  • Formula: C206H340N60O63S
  • Characteristics: None
  • Reference: None
Email us

PEPTIDE@QYAOBIO.COM

Call Us

+86(021)-50795728
+86(027)-60707970