Endothelin Peptide

Home » Peptide » Catalog Peptides » Endothelin Peptide

Endothelins are 21-amino acid vasoconstricting peptides. These peptides can constrict blood vessels and raise blood pressure, in order to keep balance of vascular homeostasis. In over-expressed situation, they will contribute to high blood pressure (hypertension), heart disease, and other potential diseases.

There are 3 isoforms of Endothelin, identified as ET-1, ET-2. ET-3.

Endothelin-1 is the most powerful endogenous chemical with affection of vascular tone. It has implication in progression and development of different cardiovascular diseases, like atherosclerosis and hypertension.

Endothelin-2 has the same affinity as endothelin-1 for ETA and ETB receptors in some situations. It differs from endothelin-1 by two amino acids. Endothelin-2 has significant impact on ovarian physiology, and pathophysiology of heart failure, immunology, and cancer.

Notice: All peptides are only for research purposes, Not for clinical use.

Endothelin Peptides

Endothelin-1 (human, bovine, dog, mouse, porcine, rat)
  • Name: Endothelin-1 (human, bovine, dog, mouse, porcine, rat)
  • Sequence: CSCSSLMDKECVYFCHLDIIW
  • CAS Number: [117399-94-7]
  • Formula: C109H159N25O32S5
  • Characteristics: Cys1 and 15 bridge, Cys3 and 11 bridge
  • Reference: A. Inoue, et al., PNAS, 80, 2863 (1989) M. Yanagisawa et al., TIPS, 10, 374 (1989) G.J. Price et al., Nucleic Acids Res., 18, 3658 (1991)
Big Endothelin-1 (1-38), human
  • Name: Big Endothelin-1 (1-38), human
  • Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS
  • CAS Number: [120796-97-6]
  • Formula: C189H282N48O56S5
  • Characteristics: Cys1 and 15 bridge, Cys3 and 11 bridge
  • Reference: Y. Itoh, et al., FEBS Letters, 231, 440 (1988) T. Kashiwabara et al., FEBS Letters, 247, 73 (1989)
Endothelin-2 (human, canine)
  • Name: Endothelin-2 (human, canine)
  • Sequence: CSCSSWLDKECVYFCHLDIIW
  • CAS Number: [123562-20-9]
  • Formula: C115H160N26O32S4
  • Characteristics: Cys1 and 15 bridge, Cys3 and 11 bridge
  • Reference: A. Inoue, et al., PNAS, 86, 2863 (1989)
Endothelin-3, human
  • Name: Endothelin-3, human
  • Sequence: CTCFTYKDKECVYYCHLDIIW
  • CAS Number: [117399-93-6]
  • Formula: C121H168N26O33S4
  • Characteristics: Cys1 and 15 bridge, Cys3 and 11 bridge
  • Reference: K. Nakajima et al., J. Cardiovasc. Pharmacol., 13, S8 (1989)  A. Inoue, et al., PNAS, 86, 2863 (1989)  M. Yanagisawa et al., PNAS, 85, 6964 (1988)
Tyr-Big Endothelin-1 fragment (22-38) (human)
  • Name: Tyr-Big Endothelin-1 fragment (22-38) (human)
  • Sequence: YVNTPEHVVPYGLGSPRS
  • CAS Number: [348128-18-7]
  • Formula: None
  • Characteristics: None
  • Reference: None
Big Endothelin-1 fragment (22-38) (human)
  • Name: Big Endothelin-1 fragment (22-38) (human)
  • Sequence: VNTPEHVVPYGLGSPRS
  • CAS Number: [124932-61-2]
  • Formula: None
  • Characteristics: None
  • Reference: None
Succinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
  • Name: Succinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
  • Sequence: (Suc)-DEEAVYFAHLDIIW
  • CAS Number: [142569-99-1]
  • Formula: None
  • Characteristics: None
  • Reference: None
(Phe22)-Big Endothelin-1 fragment (19-37) (human)
  • Name: (Phe22)-Big Endothelin-1 fragment (19-37) (human)
  • Sequence: IIWFNTPEHVVPYGLGSPR
  • CAS Number: [189064-07-1]
  • Formula: None
  • Characteristics: None
  • Reference: None
Endothelin (16-21)
  • Name: Endothelin (16-21)
  • Sequence: HLDIIW
  • CAS Number: [121377-67-1]
  • Formula: None
  • Characteristics: None
  • Reference: None
Email us

PEPTIDE@QYAOBIO.COM

Call Us

+86(021)-50795728
+86(027)-60707970