Endothelin Peptide
Endothelins are 21-amino acid vasoconstricting peptides. These peptides can constrict blood vessels and raise blood pressure, in order to keep balance of vascular homeostasis. In over-expressed situation, they will contribute to high blood pressure (hypertension), heart disease, and other potential diseases.
There are 3 isoforms of Endothelin, identified as ET-1, ET-2. ET-3.
Endothelin-1 is the most powerful endogenous chemical with affection of vascular tone. It has implication in progression and development of different cardiovascular diseases, like atherosclerosis and hypertension.
Endothelin-2 has the same affinity as endothelin-1 for ETA and ETB receptors in some situations. It differs from endothelin-1 by two amino acids. Endothelin-2 has significant impact on ovarian physiology, and pathophysiology of heart failure, immunology, and cancer.
Notice: All peptides are only for research purposes, Not for clinical use.
Endothelin Peptides

- Name: Endothelin-1 (human, bovine, dog, mouse, porcine, rat)
- Sequence: CSCSSLMDKECVYFCHLDIIW
- CAS Number: [117399-94-7]
- Formula: C109H159N25O32S5
- Characteristics: Cys1 and 15 bridge, Cys3 and 11 bridge
- Reference: A. Inoue, et al., PNAS, 80, 2863 (1989) M. Yanagisawa et al., TIPS, 10, 374 (1989) G.J. Price et al., Nucleic Acids Res., 18, 3658 (1991)

- Name: Big Endothelin-1 (1-38), human
- Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS
- CAS Number: [120796-97-6]
- Formula: C189H282N48O56S5
- Characteristics: Cys1 and 15 bridge, Cys3 and 11 bridge
- Reference: Y. Itoh, et al., FEBS Letters, 231, 440 (1988) T. Kashiwabara et al., FEBS Letters, 247, 73 (1989)

- Name: Endothelin-2 (human, canine)
- Sequence: CSCSSWLDKECVYFCHLDIIW
- CAS Number: [123562-20-9]
- Formula: C115H160N26O32S4
- Characteristics: Cys1 and 15 bridge, Cys3 and 11 bridge
- Reference: A. Inoue, et al., PNAS, 86, 2863 (1989)

- Name: Endothelin-3, human
- Sequence: CTCFTYKDKECVYYCHLDIIW
- CAS Number: [117399-93-6]
- Formula: C121H168N26O33S4
- Characteristics: Cys1 and 15 bridge, Cys3 and 11 bridge
- Reference: K. Nakajima et al., J. Cardiovasc. Pharmacol., 13, S8 (1989) A. Inoue, et al., PNAS, 86, 2863 (1989) M. Yanagisawa et al., PNAS, 85, 6964 (1988)

- Name: Tyr-Big Endothelin-1 fragment (22-38) (human)
- Sequence: YVNTPEHVVPYGLGSPRS
- CAS Number: [348128-18-7]
- Formula: None
- Characteristics: None
- Reference: None

- Name: Big Endothelin-1 fragment (22-38) (human)
- Sequence: VNTPEHVVPYGLGSPRS
- CAS Number: [124932-61-2]
- Formula: None
- Characteristics: None
- Reference: None

- Name: Succinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21)
- Sequence: (Suc)-DEEAVYFAHLDIIW
- CAS Number: [142569-99-1]
- Formula: None
- Characteristics: None
- Reference: None

- Name: (Phe22)-Big Endothelin-1 fragment (19-37) (human)
- Sequence: IIWFNTPEHVVPYGLGSPR
- CAS Number: [189064-07-1]
- Formula: None
- Characteristics: None
- Reference: None

- Name: Endothelin (16-21)
- Sequence: HLDIIW
- CAS Number: [121377-67-1]
- Formula: None
- Characteristics: None
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970