Glucagon Like Peptide

Home » Peptide » Catalog Peptides » GLP

Glucagon-like peptide-1 (GLP-1) is a 30- or 31- amino acid peptide hormone, it is deriving from the tissue-specific post-translational processing of the proglucagon peptide. This peptide is secreted by intesinal enteroendocrine L-cells and certain neurons in the brainstem upon food consumption. Alongside GIP, GLP-1 is an incretin.

The initial GLP-1(1-37) is susceptible to amidation and poteolytic cleavage, this results in two active forms, GLP-1 (7-36) amide, GLP-1(7-37). Active GLP-1 protein includes two α-helices from AA postion 13-20 and 24-35 separately by a linker region.

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide, it is secreted by specific post-translational proteolytic cleavage of proglucagon. This process alos liberates the GLP-1. GlP-2 is co-secreted along with GLP-1 upon nutrient ingestion in intestine.

Notice: All peptides are only for research purposes, Not for clinical use.

Glucagon-like peptides

1.GLP-2, human-Glucagon-Like Peptide-2 (1-33), human
  • Name: GLP-2, human|Glucagon-Like Peptide-2 (1-33), human
  • Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
  • CAS Number: [223460-79-5]
  • Formula: C165H254N44O55S1
  • Characteristics: None
  • Reference: None
2.Glucagon (1-29), bovine, human, porcine
  • Name: Glucagon (1-29), bovine, human, porcine
  • Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
  • CAS Number: [16941-32-5]
  • Formula: C153H225N43O49S1
  • Characteristics: None
  • Reference: None
3.Glucagon-Like Peptide I (7-36), amide, human
  • Name: Glucagon-Like Peptide I (7-36), amide, human
  • Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
  • CAS Number: [107444-51-9]
  • Formula: C149H226N40O45
  • Characteristics: None
  • Reference: G. Bell et al., Nature, 304, 368 (1983)
4.Glucagon-Like Peptide II, humanPeptide-2 (1-34)
  • Name: Glucagon-Like Peptide II, human|Peptide-2 (1-34)
  • Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
  • CAS Number: [99120-49-7]
  • Formula: C171H266N48O56S1
  • Characteristics: None
  • Reference: D.J. Drucker, Trends Endocrinol. Metab., 10, 153 (1999)  D.J. Drucker et al., J. Parenter. Enteral Nutr., 23, 598 (1999)
5.Oxyntomodulin ,Glucagon (1-37) human, mouse, rat
  • Name: Oxyntomodulin ,Glucagon (1-37) human, mouse, rat
  • Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
  • CAS Number: [159002-68-3]
  • Formula: C192H295N61O60S1
  • Characteristics: None
  • Reference: C.L.Dakin et al., Endocrinology , 142, 4244 (2001)
6.Glucagon-Like Peptide-1 (7-37)GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)
  • Name: Glucagon-Like Peptide-1 (7-37)|GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat)
  • Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
  • CAS Number: [106612-94-6]
  • Formula: C151H228N40O47
  • Characteristics: None
  • Reference: J.M.Conlon, Regul. Peptides , 93 3 (2000)  D.J.Drucker, Gut , 50, 428 (2002)  D.J.Drucker, Gastroenterology , 122, 531 (2002)
Email us

PEPTIDE@QYAOBIO.COM

Call Us

+86(021)-50795728
+86(027)-60707970