Kinase

Home » Peptide » Catalog Peptides » Kinase

Kinase is an enzyme to catalyze the transfer of phosphate groups from high-energy, phosphate-donating molecules to specific substrates. Kinases are part of the phosphotransferases family.

Protein kinases are the key regulators in most biological process, and linked with many human diseases. Therefore, protein kinase related peptides are the attractive targets for drug design researches. These intracellularly active peptides have kinase function or kinase-mediated signaling pathways, protein kinase related peptides are potential drug compounds with therapeutic implications.

Notice: All peptides are only for research purposes, Not for clinical use.

Kinase

1.Calmodulin Dependent Protein Kinase II (290-309)
  • Name: Calmodulin Dependent Protein Kinase II (290-309)
  • Sequence: LKKFNARRKLKGAILTTMLA
  • CAS Number: [115044-69-4]
  • Formula: C103H185N31O24S1
  • Characteristics: None
  • Reference: M.E. Payne et al., JBC, 263, 7190 (1989)
2.Calmodulin Dependent Protein Kinase Substrate
  • Name: Calmodulin Dependent Protein Kinase Substrate
  • Sequence: PLSRTLSVSS-NH2
  • CAS Number: None
  • Formula: C44H80N14O15
  • Characteristics: None
  • Reference: None
3.Calmodulin Dependent Protein Kinase Substrate Analog
  • Name: Calmodulin Dependent Protein Kinase Substrate Analog
  • Sequence: PLRRTLSVAA-NH2
  • CAS Number: None
  • Formula: C47H87N17O12
  • Characteristics: None
  • Reference: None
4.Casein Kinase II Substrate
  • Name: Casein Kinase II Substrate
  • Sequence: RRREEETEEE
  • CAS Number: None
  • Formula: C52H87N19O24
  • Characteristics: None
  • Reference: E.A. Kuenzel et al., Proc. Natl. Acad. Sci. USA, 82, 737 (1985)
5.Myosin Kinase Inhibiting Peptide
  • Name: Myosin Kinase Inhibiting Peptide
  • Sequence: KKRAARATS-NH2
  • CAS Number: None
  • Formula: C40H78N18O11
  • Characteristics: None
  • Reference: R.B. Pearson et al., JBC, 261, 25 (1986)
6.Protein Kinase p34(cd2) Substrate
  • Name: Protein Kinase p34(cd2) Substrate
  • Sequence: ADAQHATPPKKKRKVEDPKDF
  • CAS Number: [135546-44-0]
  • Formula: C106H172N32O32
  • Characteristics: None
  • Reference: D. McVey et al., Nature, 341, 503 ( 1989)
7.P34cdc2 Kinase Fragment
  • Name: P34cdc2 Kinase Fragment
  • Sequence: CDNQIKKM
  • CAS Number: None
  • Formula: C39H70N12O13S2
  • Characteristics: None
  • Reference: M. Lee et al., Nature, 327, 31 (1987)
8.Phosphorylase Kinase beta-Subunit Fragment (420-436)
  • Name: Phosphorylase Kinase beta-Subunit Fragment (420-436)
  • Sequence: KRNPGSQKRFPSNCGRD
  • CAS Number: [150829-21-3]
  • Formula: C79H131N31O25S1
  • Characteristics: None
  • Reference: V.E. Sanchez et al., J. Bio. Chem., 268, 17889 (1993)
9.Protein Kinase A Inhibitor (6-22), amide
  • Name: Protein Kinase A Inhibitor (6-22), amide
  • Sequence: TYADFIASGRTGRRNAI-NH2
  • CAS Number: None
  • Formula: C80H130N28O24
  • Characteristics: None
  • Reference: D.B. Glass et al., JBC, 264, 1457 (1989)
10.Protein Kinase C (19-35) Peptide
  • Name: Protein Kinase C (19-35) Peptide
  • Sequence: RFARKGALRQKNVHEVK
  • CAS Number: None
  • Formula: C89H153N33O22
  • Characteristics: None
  • Reference: None
11.Protein Kinase C (alpha) Peptide
  • Name: Protein Kinase C (alpha) Peptide
  • Sequence: AGNKVISPSEDRRQC
  • CAS Number: [159939-84-1]
  • Formula: C66H114N24O24S1
  • Characteristics: None
  • Reference: None
12.Protein Kinase C (beta) Peptide
  • Name: Protein Kinase C (beta) Peptide
  • Sequence: GPKTPEEKTANTISKFDC
  • CAS Number: None
  • Formula: C84H136N22O30S1
  • Characteristics: None
  • Reference: None
13.Protein Kinase C (gamma) Peptide
  • Name: Protein Kinase C (gamma) Peptide
  • Sequence: NYPLELYERVRTGC
  • CAS Number: None
  • Formula: C75H117N21O23S1
  • Characteristics: None
  • Reference: None
14.Protein Kinase C-epsilon Translocation Inh
  • Name: Protein Kinase C-epsilon Translocation Inh
  • Sequence: LSETKPAV
  • CAS Number: None
  • Formula: C37H65N9O13
  • Characteristics: None
  • Reference: None
15.Casein Kinase II Receptor Peptide
  • Name: Casein Kinase II Receptor Peptide
  • Sequence: RREEETEEE
  • CAS Number: [198481-81-1]
  • Formula: C46H75N15O23
  • Characteristics: None
  • Reference: R. Kissmehl et al., Febs Letters, 402, 227 (1997)
16.S6-1,S6 Kinase Substrate (232-239)
  • Name: S6-1,S6 Kinase Substrate (232-239)
  • Sequence: RRLSSLRA
  • CAS Number: [9362-74-9]
  • Formula: C39H75N17O11
  • Characteristics: None
  • Reference: None
17.S6 Kinase Substrate Peptide 32
  • Name: S6 Kinase Substrate Peptide 32
  • Sequence: KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK
  • CAS Number: None
  • Formula: C149H270N56O49
  • Characteristics: None
  • Reference: None
18.[Ser25] Protein Kinase C (19-31)
  • Name: [Ser25] Protein Kinase C (19-31)
  • Sequence: RFARKGSLRQKNV
  • CAS Number: [136795-05-6]
  • Formula: C67H118N26O17
  • Characteristics: None
  • Reference: C. House et al., Science, 238, 1726 (1987)  
19.Calmodulin-Dependent Protein Kinase I (299)
  • Name: Calmodulin-Dependent Protein Kinase I (299)
  • Sequence: AKSKWKQAFNATAVVRHMRKLQ
  • CAS Number: None
  • Formula: C116H192N38O28S1
  • Characteristics: None
  • Reference: Yuan, t. et al. Arch. Biochem. Biophys. 421, 192 (2004)
20.cAMP-Dependent Protein Kinase Inhibitor-α(5-24)
  • Name: cAMP-Dependent Protein Kinase Inhibitor-α(5-24) (human, mouse, rabbit, rat)
  • Sequence: TTYADFIASGRTGRRNAIHD
  • CAS Number: [99534-03-9]
  • Formula: None
  • Characteristics: None
  • Reference: None
21.[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302)
  • Name: [Ala286]-Calmodulin-Dependent Protein Kinase II (281-302)
  • Sequence: MHRQEAVDCLKKFNARRKLKGA
  • CAS Number: [141055-85-8]
  • Formula: C111H191N39O29S2
  • Characteristics: None
  • Reference: None
22.[pY185]-MAP (177-189) kinase
  • Name: [pY185]-MAP (177-189) kinase
  • Sequence: DHTGFLTE-(p-Y)-VATR
  • CAS Number: None
  • Formula: C67H100N18O22
  • Characteristics: None
  • Reference: None
23.Biotin-Kinase Domain of Insulin Receptor (2)
  • Name: Biotin-Kinase Domain of Insulin Receptor (2)
  • Sequence: Biotin-TRDIPYETDYYRK
  • CAS Number: None
  • Formula: C72H122N21O29PS
  • Characteristics: None
  • Reference: None
24.Biotin-Kinase Domain of Insulin Receptor (5)
  • Name: Biotin-Kinase Domain of Insulin Receptor (5)
  • Sequence: Biotin-TRDIPYETDPYPYRK
  • CAS Number: None
  • Formula: C82H124N21O35P3S
  • Characteristics: None
  • Reference: None
25.Biotin-LC-Protein Kinase G Substrate
  • Name: Biotin-LC-Protein Kinase G Substrate
  • Sequence: Biotin-LCQKRPRRKDTP
  • CAS Number: None
  • Formula: C69H121N25O18S
  • Characteristics: None
  • Reference: None
26.Biotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
  • Name: Biotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
  • Sequence: Biotin- RRLIEDAEYAARG
  • CAS Number: None
  • Formula: C74H120N24O23S
  • Characteristics: None
  • Reference: None
27.Biotin-Tyrosine Kinase Peptide 1 amide
  • Name: Biotin-Tyrosine Kinase Peptide 1 amide
  • Sequence: Biotin-KVEKIGEGTYGVVYK-NH2
  • CAS Number: None
  • Formula: C87H139N21O24S
  • Characteristics: None
  • Reference: None
28.Calcium/Calmodulin Dependent Protein Kinase II-g (345-358)
  • Name: Calcium/Calmodulin Dependent Protein Kinase II-g (345-358)
  • Sequence: KSDGGVKKRKSSSS
  • CAS Number: None
  • Formula: C58H107N21O22
  • Characteristics: None
  • Reference: None
29.Calmodulin-Dependent Protein Kinase II (281-289)
  • Name: Calmodulin-Dependent Protein Kinase II (281-289)
  • Sequence: MHRQETVDC
  • CAS Number: None
  • Formula: C43H71N15O16S2
  • Characteristics: None
  • Reference: None
30.Calmodulin-Dependent Protein Kinase II (281-309)
  • Name: Calmodulin-Dependent Protein Kinase II (281-309)
  • Sequence: MHRQETVDCLKKFNARRKLKGAILTTMLA
  • CAS Number: None
  • Formula: C146H254N46O39S3
  • Characteristics: None
  • Reference: None
31.cAMP Dependent Protein Kinase Substrate
  • Name: cAMP Dependent Protein Kinase Substrate
  • Sequence: RRKASGP
  • CAS Number: [65189-70-0]  
  • Formula: C31H58N14O9
  • Characteristics: None
  • Reference: None
32.Casein Kinase II Assay Peptide
  • Name: Casein Kinase II Assay Peptide
  • Sequence: RRRDDDSDDD
  • CAS Number: None
  • Formula: C45H73N19O24 
  • Characteristics: None
  • Reference: None
33.Kinase Domain of Insulin Receptor (1)
  • Name: Kinase Domain of Insulin Receptor (1)
  • Sequence: YETDPYYRKGGKGL
  • CAS Number: None
  • Formula: C70H105N18O25P
  • Characteristics: None
  • Reference: None
34.Kinase Domain of Insulin Receptor (2)
  • Name: Kinase Domain of Insulin Receptor (2)
  • Sequence: TRDIPYETDYYRK
  • CAS Number: None 
  • Formula: C72H108N19O27P
  • Characteristics: None
  • Reference: None
35.Kinase Domain of Insulin Receptor (5)
  • Name: Kinase Domain of Insulin Receptor (5)
  • Sequence: TRDIPYETDPYPYRK
  • CAS Number: None
  • Formula: C72H110N19O33P3
  • Characteristics: None
  • Reference: None
36.Kinase Domain of Pyruvate Kinase, porcine liver
  • Name: Kinase Domain of Pyruvate Kinase, porcine liver
  • Sequence: LRRAPSLG
  • CAS Number: None
  • Formula: C32H62N12O13P
  • Characteristics: None
  • Reference: None
37.MAP Kinase Substrate
  • Name: MAP Kinase Substrate
  • Sequence: KRELVEPLTPSGEAPNQALLR
  • CAS Number: None 
  • Formula: C101H172N30O32
  • Characteristics: None
  • Reference: None
38.Myristoylated Protein Kinase C (19-31)
  • Name: Myristoylated Protein Kinase C (19-31)
  • Sequence: MYRISTOYLRFARKGALRQKNV
  • CAS Number: None
  • Formula: C81H144N26O26
  • Characteristics: None
  • Reference: None
39.Phosphorylated Protein Kinase C Substrate 1
  • Name: Phosphorylated Protein Kinase C Substrate 1
  • Sequence: KRPPSQRHGSKY-NH2
  • CAS Number: None
  • Formula: C57H96N23O18P
  • Characteristics: None
  • Reference: None
40.Phosphorylated Protein Kinase C Substrate 2
  • Name: Phosphorylated Protein Kinase C Substrate 2
  • Sequence: KRPTIRR
  • CAS Number: None 
  • Formula: C34H69N16O11P
  • Characteristics: None
  • Reference: None
41.Protein Kinase A Substrate
  • Name: Protein Kinase A Substrate
  • Sequence: GRGLSLSR
  • CAS Number: [57836-10-9]
  • Formula: C34H64N14O11
  • Characteristics: None
  • Reference: None
42.Protein Kinase C (19-31)
  • Name: Protein Kinase C (19-31)
  • Sequence: RFARKGALRQKNV
  • CAS Number: [121545-65-1]
  • Formula: C67H118N26O16
  • Characteristics: None
  • Reference: None
43.Protein Kinase C (19-36)
  • Name: Protein Kinase C (19-36)
  • Sequence: RFARKGALRQKNVHEVKN
  • CAS Number: [113731-96-7]
  • Formula: C93H159N35O24
  • Characteristics: None
  • Reference: None
44.Protein Kinase C (530-558)
  • Name: Protein Kinase C (530-558)
  • Sequence: LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2
  • CAS Number: [122613-29-0]
  • Formula: C148H220N34O51S2
  • Characteristics: None
  • Reference: None
45.Protein Kinase C Substrate
  • Name: Protein Kinase C Substrate
  • Sequence: VRKRTLRRL
  • CAS Number: [105802-82-2]
  • Formula: C51H100N22O11
  • Characteristics: None
  • Reference: None
46.Protein Kinase C substrate from EGF Receptor
  • Name: Protein Kinase C substrate from EGF Receptor
  • Sequence: KRTLRR
  • CAS Number: [121284-21-7]
  • Formula: C34H68N16O8
  • Characteristics: None
  • Reference: None
47.Protein Kinase C Substrate, Glycogen Synthase (1-8)
  • Name: Protein Kinase C Substrate, Glycogen Synthase (1-8)
  • Sequence: PLSRTLSVAAKK-NH2
  • CAS Number: None
  • Formula: C56H104N18O15
  • Characteristics: None
  • Reference: None
48.Protein Kinase G Substrate
  • Name: Protein Kinase G Substrate
  • Sequence: QKRPRRKDTP
  • CAS Number: None
  • Formula: C53H96N22O15
  • Characteristics: None
  • Reference: None
49.SRC Kinase Substrate
  • Name: SRC Kinase Substrate
  • Sequence: RRLIEDAEPYAARG
  • CAS Number: None
  • Formula: C64H107N22O24P
  • Characteristics: None
  • Reference: None
50. SRC Kinase Substrate amide
  • Name: SRC Kinase Substrate amide
  • Sequence: RRLIEDAEPYAARG-NH2
  • CAS Number: None
  • Formula: C64H108N23O23P
  • Characteristics: None
  • Reference: None
51.Ac-Tyrosine Kinase Peptide 3 amide, (phosphorylated)
  • Name: Ac-Tyrosine Kinase Peptide 3 amide, (phosphorylated)
  • Sequence: Ac-RRLIEDAEPYAARG-NH2
  • CAS Number: None
  • Formula: C66H110N23O24P
  • Characteristics: None
  • Reference: None
52.Tyrosine Protein Kinase JAK 2
  • Name: Tyrosine Protein Kinase JAK 2
  • Sequence: VLPQDKEPYPYKVKEPGE
  • CAS Number: None
  • Formula: C88H137N20O31P
  • Characteristics: None
  • Reference: None
Email us

PEPTIDE@QYAOBIO.COM

Call Us

+86(021)-50795728
+86(027)-60707970