Kinase
Kinase is an enzyme to catalyze the transfer of phosphate groups from high-energy, phosphate-donating molecules to specific substrates. Kinases are part of the phosphotransferases family.
Protein kinases are the key regulators in most biological process, and linked with many human diseases. Therefore, protein kinase related peptides are the attractive targets for drug design researches. These intracellularly active peptides have kinase function or kinase-mediated signaling pathways, protein kinase related peptides are potential drug compounds with therapeutic implications.
Notice: All peptides are only for research purposes, Not for clinical use.
Kinase

- Name: Calmodulin Dependent Protein Kinase II (290-309)
- Sequence: LKKFNARRKLKGAILTTMLA
- CAS Number: [115044-69-4]
- Formula: C103H185N31O24S1
- Characteristics: None
- Reference: M.E. Payne et al., JBC, 263, 7190 (1989)

- Name: Calmodulin Dependent Protein Kinase Substrate
- Sequence: PLSRTLSVSS-NH2
- CAS Number: None
- Formula: C44H80N14O15
- Characteristics: None
- Reference: None

- Name: Calmodulin Dependent Protein Kinase Substrate Analog
- Sequence: PLRRTLSVAA-NH2
- CAS Number: None
- Formula: C47H87N17O12
- Characteristics: None
- Reference: None

- Name: Casein Kinase II Substrate
- Sequence: RRREEETEEE
- CAS Number: None
- Formula: C52H87N19O24
- Characteristics: None
- Reference: E.A. Kuenzel et al., Proc. Natl. Acad. Sci. USA, 82, 737 (1985)

- Name: Myosin Kinase Inhibiting Peptide
- Sequence: KKRAARATS-NH2
- CAS Number: None
- Formula: C40H78N18O11
- Characteristics: None
- Reference: R.B. Pearson et al., JBC, 261, 25 (1986)

- Name: Protein Kinase p34(cd2) Substrate
- Sequence: ADAQHATPPKKKRKVEDPKDF
- CAS Number: [135546-44-0]
- Formula: C106H172N32O32
- Characteristics: None
- Reference: D. McVey et al., Nature, 341, 503 ( 1989)

- Name: P34cdc2 Kinase Fragment
- Sequence: CDNQIKKM
- CAS Number: None
- Formula: C39H70N12O13S2
- Characteristics: None
- Reference: M. Lee et al., Nature, 327, 31 (1987)

- Name: Phosphorylase Kinase beta-Subunit Fragment (420-436)
- Sequence: KRNPGSQKRFPSNCGRD
- CAS Number: [150829-21-3]
- Formula: C79H131N31O25S1
- Characteristics: None
- Reference: V.E. Sanchez et al., J. Bio. Chem., 268, 17889 (1993)

- Name: Protein Kinase A Inhibitor (6-22), amide
- Sequence: TYADFIASGRTGRRNAI-NH2
- CAS Number: None
- Formula: C80H130N28O24
- Characteristics: None
- Reference: D.B. Glass et al., JBC, 264, 1457 (1989)

- Name: Protein Kinase C (19-35) Peptide
- Sequence: RFARKGALRQKNVHEVK
- CAS Number: None
- Formula: C89H153N33O22
- Characteristics: None
- Reference: None

- Name: Protein Kinase C (alpha) Peptide
- Sequence: AGNKVISPSEDRRQC
- CAS Number: [159939-84-1]
- Formula: C66H114N24O24S1
- Characteristics: None
- Reference: None

- Name: Protein Kinase C (beta) Peptide
- Sequence: GPKTPEEKTANTISKFDC
- CAS Number: None
- Formula: C84H136N22O30S1
- Characteristics: None
- Reference: None

- Name: Protein Kinase C (gamma) Peptide
- Sequence: NYPLELYERVRTGC
- CAS Number: None
- Formula: C75H117N21O23S1
- Characteristics: None
- Reference: None

- Name: Protein Kinase C-epsilon Translocation Inh
- Sequence: LSETKPAV
- CAS Number: None
- Formula: C37H65N9O13
- Characteristics: None
- Reference: None

- Name: Casein Kinase II Receptor Peptide
- Sequence: RREEETEEE
- CAS Number: [198481-81-1]
- Formula: C46H75N15O23
- Characteristics: None
- Reference: R. Kissmehl et al., Febs Letters, 402, 227 (1997)

- Name: S6-1,S6 Kinase Substrate (232-239)
- Sequence: RRLSSLRA
- CAS Number: [9362-74-9]
- Formula: C39H75N17O11
- Characteristics: None
- Reference: None

- Name: S6 Kinase Substrate Peptide 32
- Sequence: KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK
- CAS Number: None
- Formula: C149H270N56O49
- Characteristics: None
- Reference: None
![18.[Ser25] Protein Kinase C (19-31)](https://www.qyaobio.com/wp-content/uploads/2024/03/18-1.jpg)
- Name: [Ser25] Protein Kinase C (19-31)
- Sequence: RFARKGSLRQKNV
- CAS Number: [136795-05-6]
- Formula: C67H118N26O17
- Characteristics: None
- Reference: C. House et al., Science, 238, 1726 (1987)

- Name: Calmodulin-Dependent Protein Kinase I (299)
- Sequence: AKSKWKQAFNATAVVRHMRKLQ
- CAS Number: None
- Formula: C116H192N38O28S1
- Characteristics: None
- Reference: Yuan, t. et al. Arch. Biochem. Biophys. 421, 192 (2004)

- Name: cAMP-Dependent Protein Kinase Inhibitor-α(5-24) (human, mouse, rabbit, rat)
- Sequence: TTYADFIASGRTGRRNAIHD
- CAS Number: [99534-03-9]
- Formula: None
- Characteristics: None
- Reference: None
![21.[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302)](https://www.qyaobio.com/wp-content/uploads/2024/03/21-1.jpg)
- Name: [Ala286]-Calmodulin-Dependent Protein Kinase II (281-302)
- Sequence: MHRQEAVDCLKKFNARRKLKGA
- CAS Number: [141055-85-8]
- Formula: C111H191N39O29S2
- Characteristics: None
- Reference: None
![22.[pY185]-MAP (177-189) kinase](https://www.qyaobio.com/wp-content/uploads/2024/03/22-1.jpg)
- Name: [pY185]-MAP (177-189) kinase
- Sequence: DHTGFLTE-(p-Y)-VATR
- CAS Number: None
- Formula: C67H100N18O22
- Characteristics: None
- Reference: None

- Name: Biotin-Kinase Domain of Insulin Receptor (2)
- Sequence: Biotin-TRDIPYETDYYRK
- CAS Number: None
- Formula: C72H122N21O29PS
- Characteristics: None
- Reference: None

- Name: Biotin-Kinase Domain of Insulin Receptor (5)
- Sequence: Biotin-TRDIPYETDPYPYRK
- CAS Number: None
- Formula: C82H124N21O35P3S
- Characteristics: None
- Reference: None

- Name: Biotin-LC-Protein Kinase G Substrate
- Sequence: Biotin-LCQKRPRRKDTP
- CAS Number: None
- Formula: C69H121N25O18S
- Characteristics: None
- Reference: None

- Name: Biotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
- Sequence: Biotin- RRLIEDAEYAARG
- CAS Number: None
- Formula: C74H120N24O23S
- Characteristics: None
- Reference: None

- Name: Biotin-Tyrosine Kinase Peptide 1 amide
- Sequence: Biotin-KVEKIGEGTYGVVYK-NH2
- CAS Number: None
- Formula: C87H139N21O24S
- Characteristics: None
- Reference: None

- Name: Calcium/Calmodulin Dependent Protein Kinase II-g (345-358)
- Sequence: KSDGGVKKRKSSSS
- CAS Number: None
- Formula: C58H107N21O22
- Characteristics: None
- Reference: None

- Name: Calmodulin-Dependent Protein Kinase II (281-289)
- Sequence: MHRQETVDC
- CAS Number: None
- Formula: C43H71N15O16S2
- Characteristics: None
- Reference: None

- Name: Calmodulin-Dependent Protein Kinase II (281-309)
- Sequence: MHRQETVDCLKKFNARRKLKGAILTTMLA
- CAS Number: None
- Formula: C146H254N46O39S3
- Characteristics: None
- Reference: None

- Name: cAMP Dependent Protein Kinase Substrate
- Sequence: RRKASGP
- CAS Number: [65189-70-0]
- Formula: C31H58N14O9
- Characteristics: None
- Reference: None

- Name: Casein Kinase II Assay Peptide
- Sequence: RRRDDDSDDD
- CAS Number: None
- Formula: C45H73N19O24
- Characteristics: None
- Reference: None

- Name: Kinase Domain of Insulin Receptor (1)
- Sequence: YETDPYYRKGGKGL
- CAS Number: None
- Formula: C70H105N18O25P
- Characteristics: None
- Reference: None

- Name: Kinase Domain of Insulin Receptor (2)
- Sequence: TRDIPYETDYYRK
- CAS Number: None
- Formula: C72H108N19O27P
- Characteristics: None
- Reference: None

- Name: Kinase Domain of Insulin Receptor (5)
- Sequence: TRDIPYETDPYPYRK
- CAS Number: None
- Formula: C72H110N19O33P3
- Characteristics: None
- Reference: None

- Name: Kinase Domain of Pyruvate Kinase, porcine liver
- Sequence: LRRAPSLG
- CAS Number: None
- Formula: C32H62N12O13P
- Characteristics: None
- Reference: None

- Name: MAP Kinase Substrate
- Sequence: KRELVEPLTPSGEAPNQALLR
- CAS Number: None
- Formula: C101H172N30O32
- Characteristics: None
- Reference: None

- Name: Myristoylated Protein Kinase C (19-31)
- Sequence: MYRISTOYLRFARKGALRQKNV
- CAS Number: None
- Formula: C81H144N26O26
- Characteristics: None
- Reference: None

- Name: Phosphorylated Protein Kinase C Substrate 1
- Sequence: KRPPSQRHGSKY-NH2
- CAS Number: None
- Formula: C57H96N23O18P
- Characteristics: None
- Reference: None

- Name: Phosphorylated Protein Kinase C Substrate 2
- Sequence: KRPTIRR
- CAS Number: None
- Formula: C34H69N16O11P
- Characteristics: None
- Reference: None

- Name: Protein Kinase A Substrate
- Sequence: GRGLSLSR
- CAS Number: [57836-10-9]
- Formula: C34H64N14O11
- Characteristics: None
- Reference: None

- Name: Protein Kinase C (19-31)
- Sequence: RFARKGALRQKNV
- CAS Number: [121545-65-1]
- Formula: C67H118N26O16
- Characteristics: None
- Reference: None

- Name: Protein Kinase C (19-36)
- Sequence: RFARKGALRQKNVHEVKN
- CAS Number: [113731-96-7]
- Formula: C93H159N35O24
- Characteristics: None
- Reference: None

- Name: Protein Kinase C (530-558)
- Sequence: LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2
- CAS Number: [122613-29-0]
- Formula: C148H220N34O51S2
- Characteristics: None
- Reference: None

- Name: Protein Kinase C Substrate
- Sequence: VRKRTLRRL
- CAS Number: [105802-82-2]
- Formula: C51H100N22O11
- Characteristics: None
- Reference: None

- Name: Protein Kinase C substrate from EGF Receptor
- Sequence: KRTLRR
- CAS Number: [121284-21-7]
- Formula: C34H68N16O8
- Characteristics: None
- Reference: None

- Name: Protein Kinase C Substrate, Glycogen Synthase (1-8)
- Sequence: PLSRTLSVAAKK-NH2
- CAS Number: None
- Formula: C56H104N18O15
- Characteristics: None
- Reference: None

- Name: Protein Kinase G Substrate
- Sequence: QKRPRRKDTP
- CAS Number: None
- Formula: C53H96N22O15
- Characteristics: None
- Reference: None

- Name: SRC Kinase Substrate
- Sequence: RRLIEDAEPYAARG
- CAS Number: None
- Formula: C64H107N22O24P
- Characteristics: None
- Reference: None

- Name: SRC Kinase Substrate amide
- Sequence: RRLIEDAEPYAARG-NH2
- CAS Number: None
- Formula: C64H108N23O23P
- Characteristics: None
- Reference: None

- Name: Ac-Tyrosine Kinase Peptide 3 amide, (phosphorylated)
- Sequence: Ac-RRLIEDAEPYAARG-NH2
- CAS Number: None
- Formula: C66H110N23O24P
- Characteristics: None
- Reference: None

- Name: Tyrosine Protein Kinase JAK 2
- Sequence: VLPQDKEPYPYKVKEPGE
- CAS Number: None
- Formula: C88H137N20O31P
- Characteristics: None
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970