Neuromedin

Home » Peptide » Catalog Peptides » Neuromedin

Neuromedins (also known as smooth-muscle-stimulating peptides) are normally divided into four groups: bombesin-like, kassinin-like, neurotensin-like and neuromedins U.

Neuromedin B (NMB) is a bombesin-related peptide in mammals. It is present in human central nervous system and gastrointestinal tract.

Neuromedin C is a gastrin-releasing peptide, it stimulates the gastrin release. Neuromedin C provides the negative feedback to regulate fear.

Neuromedin U (NmU or NMU) is a neuropeptide in brain of mammals, it has diverse functions in regulation of blood pressure, contraction of smooth muscle, pain perception, bone growth, appetite, hormone release.

Neuromedin S is a neuropeptide with 36-amino acid in the brain of mammals. It is secreted in suprachiasmatic nucleus of the hypothalamus.

Notice: All peptides are only for research purposes, Not for clinical use.

Neuromedin

1.Neuromedin B, porcine
  • Name: Neuromedin B, porcine
  • Sequence: GNLWATGHFM-NH2
  • CAS Number: [87096-84-2]
  • Formula: C52H73N15O12S1
  • Characteristics: None
  • Reference: None
2.Neuromedin C, porcine
  • Name: Neuromedin C, porcine
  • Sequence: GNHWAVGHLM-NH2
  • CAS Number: [81608-30-2]
  • Formula: C50H73N17O11S1
  • Characteristics: None
  • Reference: K.A. Roth et al., BBRC, 112, 528 (1983)
3.Neuromedin U-23, rat
  • Name: Neuromedin U-23, rat
  • Sequence: YKVNEYQGPVAPSGGFFLFRPRN-NH2
  • CAS Number: [117505-80-3]
  • Formula: C124H180N34O31
  • Characteristics: None
  • Reference: N. Minamino et al., BBRC, 156, 685 (1984)
4.[Leu116]-Prepro-Neuromedin U (104-136), human
  • Name: [Leu116]-Prepro-Neuromedin U (104-136), human
  • Sequence: FLFHYSKTQKLGLSNVVSSVVHPLLQLVPHLHE
  • CAS Number: None
  • Formula: C177H276N46O45
  • Characteristics: None
  • Reference: None
5. [Ser2]-Neuromedin C
  • Name:  [Ser2]-Neuromedin C
  • Sequence: GSHWAVGHLM-NH2
  • CAS Number: [136058-54-3]
  • Formula: C67H87N15O14
  • Characteristics: None
  • Reference: None
6.Biotin-Neuromedin B
  • Name: Biotin-Neuromedin B
  • Sequence: Biotin-GNLWATGHFM-NH2
  • CAS Number: None
  • Formula: C62H87N17O14S2
  • Characteristics: None
  • Reference: None
7.Biotin-Neuromedin S, human
  • Name: Biotin-Neuromedin S, human
  • Sequence: Biotin-ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2
  • CAS Number: None
  • Formula: C183H279N55O46S
  • Characteristics: None
  • Reference: None
8.Biotin-Neuromedin S, rat
  • Name: Biotin-Neuromedin S, rat
  • Sequence: Biotin-LPRLLHTDSRMATIDFPKKDPTTSLGRPFFLFRPRN-NH2
  • CAS Number: None
  • Formula: C202H321N59O5S2
  • Characteristics: None
  • Reference: None
9.Prepro-Neuromedin S (70-103), human
  • Name: Prepro-Neuromedin S (70-103), human
  • Sequence: FLFHYSRTQEATHPVKTGFPPVHPLMHLAAKLAN
  • CAS Number: None
  • Formula: C180H271N49O44S
  • Characteristics: None
  • Reference: None
10.Prepro-Neuromedin U (104-136), human
  • Name: Prepro-Neuromedin U (104-136), human
  • Sequence: FLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHE
  • CAS Number: None
  • Formula: C177H277N47O45
  • Characteristics: None
  • Reference: None
Email us

PEPTIDE@QYAOBIO.COM

Call Us

+86(021)-50795728
+86(027)-60707970