Neuropeptide Y
Neuropeptide Y (NPY) is a 36 amino-acid neuropeptide, it is involved in different physiological and homeostatic processes in both central and peripheral nervous systems. Normally, it is secreted alongside other neurotransmitters like: GABA and glutamate.
It is a strong vasoconstrictor, and causes growth of fat tissue in the autonomic system. In the brain, it has several functions, including: controlling epileptic seizures, lowering blood pressure, reducing pain perception, reducing anxiety and stress, affecting the circadian rhythm, increasing food intake and storage.
Notice: All peptides are only for research purposes, Not for clinical use.
NPY Peptides
- Name: Neuropeptide Y, porcine
- Sequence: YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2
- CAS Number: [83589-17-7]
- Formula: C190H287N55O57
- Characteristics: None
- Reference: K. Tatemoto et al., PNAS, 79, 5485 (1982)
- Name: Neuropeptide FF; F-8-F-NH2
- Sequence: FLFQPQRF-NH2
- CAS Number: [99566-27-5]
- Formula: C54H76N14O10
- Characteristics: None
- Reference: M.Xu et al., Peptides, 22, 33 (2001) C.Mollereau et al., Pharmacol. Rep., 63, 1061 (2011)
- Name: Neuropeptide Y, human,rat
- Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
- CAS Number: [90880-35-6]
- Formula: C189H285N55O57S1
- Characteristics: None
- Reference: Minth, C. et al. Proc. Natl. Acad. Sci. USA 81, 4577 (1984)
![4.[Leu31,Pro34] Neuropeptide Y, human](https://www.qyaobio.com/wp-content/uploads/2023/07/4.Leu31Pro34-Neuropeptide-Y-human.jpg)
- Name: [Leu31,Pro34] Neuropeptide Y, human
- Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2
- CAS Number: [132699-73-1]
- Formula: C189H284N54O56S1
- Characteristics: None
- Reference: Chen, S. and RJ. Cheung, Biomed. Sci. 11, 781 (2004) Chen, S. and RJ. Cheung, Biomed. Sci.12, 267 (2005)
- Name: Neuropeptide Y, human, Free Acid
- Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
- CAS Number: [99575-89-0]
- Formula: C189H284N54O58S1
- Characteristics: None
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970