P53 Peptide

Home » Peptide » Catalog Peptides » P53 Peptide

p53 is a regulatory protein, it is also known as cellular tumor antigen p53 (UniProt name), transformation-related protein 53 (TRP53), tumor protein P53. The p53 proteins are crucial in vertebrates to prevent cancer formation. P53 is able to conserving stability by preventing genome mutation.

Notice: All peptides are only for research purposes, Not for clinical use.

p53 Peptide

1.p53 Activator, Cell-Permeable
  • Name: p53 Activator, Cell-Permeable
  • Sequence: GSRAHSSHLKSKKGQSTSRHKKWKMRRNQFWVKVQRG
  • CAS Number: None
  • Formula: C192H315N71O49S1
  • Characteristics: None
  • Reference: G. Selivanova, et al., Mol. Cell Biol. 19, 3395 (1999)
2.p53 (361-380)
  • Name: p53 (361-380)
  • Sequence: GSRAHSSHLKSKKGQSTSRH
  • CAS Number: None
  • Formula: C88H150N36O29
  • Characteristics: None
  • Reference: Kubbutat, M. et al. Lett Nature 387, 299 (1997)
Email us

PEPTIDE@QYAOBIO.COM

Call Us

+86(021)-50795728
+86(027)-60707970