P53 Peptide
p53 is a regulatory protein, it is also known as cellular tumor antigen p53 (UniProt name), transformation-related protein 53 (TRP53), tumor protein P53. The p53 proteins are crucial in vertebrates to prevent cancer formation. P53 is able to conserving stability by preventing genome mutation.
Notice: All peptides are only for research purposes, Not for clinical use.
p53 Peptide

- Name: p53 Activator, Cell-Permeable
- Sequence: GSRAHSSHLKSKKGQSTSRHKKWKMRRNQFWVKVQRG
- CAS Number: None
- Formula: C192H315N71O49S1
- Characteristics: None
- Reference: G. Selivanova, et al., Mol. Cell Biol. 19, 3395 (1999)

- Name: p53 (361-380)
- Sequence: GSRAHSSHLKSKKGQSTSRH
- CAS Number: None
- Formula: C88H150N36O29
- Characteristics: None
- Reference: Kubbutat, M. et al. Lett Nature 387, 299 (1997)
Call Us
+86(021)-50795728
+86(027)-60707970