Prolactin Releasing Peptide
Prolactin-releasing peptide (PrRP) is a peptide hormone, which is encoded by the PRLH gene. PrRP stimulates the release of prolactin (PRL), and regulates the expression of prolactin by binding to the prolactin-releasing peptide receptor (GPR10).
PrRP has 20 amino acids, it is a member of RF-amide peptide family. PrRP is a ligand for the orphan G-protein coupled receptor (GPR 10), it stimulate the secretion of prolactin from lactotropic cells.
Notice: All peptides are only for research purposes, Not for clinical use.
Prolactin Releasing Peptide
- Name: Prolactin Releasing Peptide (1-31), human
- Sequence: SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
- CAS Number: [215510-22-8]
- Formula: C160H252N56O42S1
- Characteristics: None
- Reference: Engström, et al. J. Pharmacol. Exp. Ther. 305, 825 (2003)
- Name: Prolactin Releasing Peptide (1-31), rat
- Sequence: SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2
- CAS Number: [215510-06-8]
- Formula: C156H242N54O43S1
- Characteristics: None
- Reference: S. Hinuma, et al. Nature, 393, 272 (1998)
Call Us
+86(021)-50795728
+86(027)-60707970