Stichodactyla helianthus Neurotoxins
Stichodactyla Helianthus Neurotoxins is a 48-amino acid peptide, it is created by the Caribbean sea anemone Stichodactyla helianthus. These peptides are applied for defense and capture of prey.
Stichodactyla helianthus neurotoxins are more active against crustacea than mammals, they can bind to the neuronal voltage-gated sodium channel. In order to slow down channel inactivation, delay the repolarization phase of the action potential.
Notice: All peptides are only for research purposes, Not for clinical use.
Stichodactyla helianthus Neurotoxins

- Name: Stichodactyla helianthus Neurotoxin (ShK)
- Sequence: RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC
- CAS Number: [172450-46-3]
- Formula: None
- Characteristics: None
- Reference: None

- Name: (Dap22)-Stichodactyla helianthus Neurotoxin (ShK)
- Sequence: RSCIDTIPKSRCTAFQCKHSM-(Dap)-YRLSFCRKTCGTC
- CAS Number: [220384-25-8]
- Formula: None
- Characteristics: None
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970