Tau Peptide

Home » Peptide » Catalog Peptides » Tau Peptide

Tau peptides (Tau proteins) belong to the microtubule-associated protein (MAP) family, which are involved in the pathogenesis of Alzheimer’s disease. Tau is abbreviated from tubulin associated unit, Tau peptides are a group of six highly soluble protein isoforms.

Tau peptides have primary roles in microtubule stability in axons, and are abundant in the neurons of the central nervous system. The cerebral cortex has the highest abundance, while at very low levels in CNS astrocytes and oligodendrocytes.

Notice: All peptides are only for research purposes, Not for clinical use.

Tau Peptide

1.Tau Peptide (244-274) (Repeat 1 domain)
  • Name: Tau Peptide (244-274) (Repeat 1 domain)
  • Sequence: Ac-QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
  • CAS Number: None
  • Formula: C143H240N42O45S1
  • Characteristics: None
  • Reference: Buee, L. et al. Brain Res Rev 33 95 (2000)
2.Tau Peptide (74-102)
  • Name: Tau Peptide (74-102)
  • Sequence: DVTAPLVDEGAPGKQAAAQPHTEIPEGTT
  • CAS Number: None
  • Formula: C124H198N34O46
  • Characteristics: None
  • Reference: Buee, L. et al. Brain Res Rev 33 95 (2000)
3.Tau Peptide (45-73)
  • Name: Tau Peptide (45-73)
  • Sequence: ESPLQTPTEDGSEEPGSETSDAKSTPTAE
  • CAS Number: None
  • Formula: C120H189N31O57
  • Characteristics: None
  • Reference: Buee, L. et al. Brain Res Rev 33 95 (2000)
4.Tau Peptide (275-305)(Repeat 2 domain)
  • Name: Tau Peptide (275-305)(Repeat 2 domain)
  • Sequence: VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS
  • CAS Number: None
  • Formula: C139H239N43O45S1
  • Characteristics: None
  • Reference: Buee, L. et al. Brain Res Rev 33 95 (2000)
5.Tau Peptide (306-336)(Repeat 3 domain)
  • Name: Tau Peptide (306-336)(Repeat 3 domain)
  • Sequence: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
  • CAS Number: None
  • Formula: C143H236N42O42S1
  • Characteristics: None
  • Reference: Buee, L. et al. Brain Res Rev 33 95 (2000)
6.Tau Peptide (337-368)(Repeat 4 domain)
  • Name: Tau Peptide (337-368)(Repeat 4 domain)
  • Sequence: VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
  • CAS Number: None
  • Formula: C150H248N44O50
  • Characteristics: None
  • Reference: Buee, L. et al. Brain Res Rev 33 95 (2000)
Call Us

+86(021)-50795728
+86(027)-60707970