Urotensin related peptides

Home » Peptide » Catalog Peptides » Urotensin related peptides

Urotensin related peptides (URP) are cyclic neuropeptides, which are found in all vertebrates. URPs have long lasting hypotensive effect, and also regulate reproduction. URP is part of the Urotensin system, it is endogenous ligands for rats, mice, and human. Urotensin-related peptide (URP) is a paralog of UII, it contains the six amino acid ring structures in UII.

Notice: All peptides are only for research purposes, Not for clinical use.

Urotensin related peptides

1.Urotensin I
  • Name: Urotensin I
  • Sequence: NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2
  • CAS Number: [83930-33-0]
  • Formula: C210H340N62O67S2
  • Characteristics: None
  • Reference: K. Lederis et al., Science, 218, 162 (1982)
2.Urotensin II , goby
  • Name: Urotensin II , goby
  • Sequence: AGTADCFWKYCV
  • CAS Number: [9047-55-6]
  • Formula: C62H84N14O17S2
  • Characteristics: (Cys6 and 11 bridge)
  • Reference: D. Pearson et al., Proc. Natl. Acad. Sci. USA, 77, 5021 (1980)
3.Urotensin II , human
  • Name: Urotensin II , human
  • Sequence: ETPDCFWKYCV
  • CAS Number: [251293-28-4]
  • Formula: C64H85N13O18S2
  • Characteristics: (Cys5 and 10 bridge)
  • Reference: K.L.Ong et al., Cardiovasc. Drugs Ther., 19, 65 (2005)
4.Orn8, Urotensin II, human
  • Name: Orn8, Urotensin II, human
  • Sequence: ETPDCFWOYCV
  • CAS Number: None
  • Formula: C63H83N13O18S2
  • Characteristics: (Cys5 and 10 bridge)
  • Reference: None
5.(Pen5)-Urotensin II (4-11) (human)
  • Name: (Pen5)-Urotensin II (4-11) (human)
  • Sequence: D-(L-Pen)-FWKYCV
  • CAS Number: [473902-31-7]
  • Formula: None
  • Characteristics: None
  • Reference: None
6.Urotensin II-Related Peptide (human, mouse, rat)
  • Name: Urotensin II-Related Peptide (human, mouse, rat)
  • Sequence: ACFWKYCV
  • CAS Number: [342878-90-4]
  • Formula: None
  • Characteristics: None
  • Reference: None
7.Urotensin II, frog
  • Name: Urotensin II, frog
  • Sequence: AGNLSECFWKYCV
  • CAS Number: None
  • Formula: C69H96N16O19S2
  • Characteristics: (Cys7-Cys12 bridge)
  • Reference: None
8.[Pyr110]-Prepro-Urotensin II (110-123), rat
  • Name: [Pyr110]-Prepro-Urotensin II (110-123), rat
  • Sequence:  (Pyr)-HGTAPECFWKYCI
  • CAS Number: None
  • Formula: C77H102N18O20S2
  • Characteristics: (Cys8-Cys13 bridge)
  • Reference: None
Email us

PEPTIDE@QYAOBIO.COM

Call Us

+86(021)-50795728
+86(027)-60707970